Structure of PDB 3qmd Chain A Binding Site BS02

Receptor Information
>3qmd Chain A (length=53) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SARMCGECEACRRTEDCGHCDFCRDMKKFGGPNKIRQKCRLRQCQLRARE
SYK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3qmd The structural basis for selective binding of non-methylated CpG islands by the CFP1 CXXC domain.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R171 R204 Q205 K206 R210 R217
Binding residue
(residue number reindexed from 1)		R3 R36 Q37 K38 R42 R49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:3qmd, PDBe:3qmd, PDBj:3qmd
PDBsum3qmd
PubMed21407193
UniProtQ9P0U4|CXXC1_HUMAN CXXC-type zinc finger protein 1 (Gene Name=CXXC1)

[Back to BioLiP]