Structure of PDB 3qi5 Chain A Binding Site BS02

Receptor Information

>3qi5 Chain A (length=206) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPHMTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLG
PEDEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACV
LLRALEPLEGLETMRQLRSTLRKVLKDRELCSGPSKLCQALAINKSFDQR
DLAQDEAVWLERGPLEPSEPAVVAAARVGVEWARKPLRFYVRGSPWVSVV
DRVAEQ

Ligand information

>3qi5 Chain D (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggcaagcatgtca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3qi5 Structural Basis for the Inhibition of Human Alkyladenine DNA Glycosylase (AAG) by 3,N4-Ethenocytosine-containing DNA.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	T143 R145 Y162 G163 M164 K229
Binding residue (residue number reindexed from 1)	T64 R66 Y83 G84 M85 K145
Binding affinity	PDBbind-CN: Kd=21nM

Enzymatic activity

Enzyme Commision number

3.2.2.21: DNA-3-methyladenine glycosylase II.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003824	catalytic activity
GO:0003905	alkylbase DNA N-glycosylase activity

	Biological Process
GO:0006284	base-excision repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3qi5, PDBe:3qi5, PDBj:3qi5
PDBsum	3qi5
PubMed	21349833
UniProt	P29372\|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]