Structure of PDB 3q6s Chain A Binding Site BS02

Receptor Information
>3q6s Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQ
VVISFYEERLTWHSYP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3q6s Mitotic centromeric targeting of HP1 and its binding to Sgo1 are dispensable for sister-chromatid cohesion in human cells.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		R167 L168 T169 W170 H171 Y173 P174
Binding residue
(residue number reindexed from 1)		R59 L60 T61 W62 H63 Y65 P66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:3q6s, PDBe:3q6s, PDBj:3q6s
PDBsum3q6s
PubMed21346195
UniProtP83916|CBX1_HUMAN Chromobox protein homolog 1 (Gene Name=CBX1)

[Back to BioLiP]