Structure of PDB 3q05 Chain A Binding Site BS02

Receptor Information
>3q05 Chain A (length=234) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFVQLAKTVPV
QLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQH
LIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCM
GGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKT
MDGEYFTLQIRGRERFEQFRERNEALELKDAQAT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3q05 An induced fit mechanism regulates p53 DNA binding kinetics to confer sequence specificity.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		V122 R248 R283
Binding residue
(residue number reindexed from 1)		V29 R155 R190
Binding affinityPDBbind-CN: Kd=7.7nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
GO:0051262 protein tetramerization
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3q05, PDBe:3q05, PDBj:3q05
PDBsum3q05
PubMed21522129
UniProtP04637|P53_HUMAN Cellular tumor antigen p53 (Gene Name=TP53)

[Back to BioLiP]