Structure of PDB 3orc Chain A Binding Site BS02

Receptor Information
>3orc Chain A (length=65) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVY
AEEVKDGEVKPFPSN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3orc Crystal structure of an engineered Cro monomer bound nonspecifically to DNA: possible implications for nonspecific binding by the wild-type protein.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		V25 Y26 A29 R38 N66
Binding residue
(residue number reindexed from 1)		V24 Y25 A28 R37 N65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3orc, PDBe:3orc, PDBj:3orc
PDBsum3orc
PubMed9684880
UniProtP03040|RCRO_LAMBD Regulatory protein cro (Gene Name=cro)

[Back to BioLiP]