Structure of PDB 3oqo Chain A Binding Site BS02

Receptor Information

>3oqo Chain A (length=333) Species: 1423 (Bacillus subtilis)

MNITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNA
VARGLASKKTTTVGVIIPDISSIFYSELARGIEDIATMYKYNIILSNSDQ
NMEKELHLLNTMLGKQVDGIVFMGGNITDEHVAEFKRSPVPIVLAASVEE
QEETPSVAIDYEQAIYDAVKLLVDKGHTDIAFVSGPMAEPINRSKKLQGY
KRALEEANLPFNEQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEM
ALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAV
AMRLLTKLMNKEPVEEHIVELPHRIELRKSTKA

Ligand information

>3oqo Chain B (length=16)

ctgaaagcgctaacag

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3oqo Structures of carbon catabolite protein A-(HPr-Ser46-P) bound to diverse catabolite response element sites reveal the basis for high-affinity binding to degenerate DNA operators.
• Resolution: 2.97 Å
• Binding residue (original residue number in PDB): M2 T5 I6 A18 S21 N25 Y47 N50 A53 R54
• Binding residue (residue number reindexed from 1): M1 T4 I5 A17 S20 N24 Y46 N49 A52 R53

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001216 DNA-binding transcription activator activity
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3oqo, PDBe:3oqo, PDBj:3oqo
• PDBsum: 3oqo
• PubMed: 21106498
• UniProt: P25144|CCPA_BACSU Catabolite control protein A (Gene Name=ccpA)