Structure of PDB 3ool Chain A Binding Site BS02

Receptor Information
>3ool Chain A (length=223) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDE
GKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKERVNHLGNLVITWGAQ
TFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDYN
KNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDS
MSYLIFYNLIKPYLIPQMMYKLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ool Evolution of I-SceI Homing Endonucleases with Increased DNA Recognition Site Specificity.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		P14 N15 K23 L80 S81 H84 K86 R88 Q102 F104 K105 Y151 N152 Q165 S166
Binding residue
(residue number reindexed from 1)		P12 N13 K21 L78 S79 H82 K84 R86 Q100 F102 K103 Y149 N150 Q163 S164
Binding affinityPDBbind-CN: Kd=20nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ool, PDBe:3ool, PDBj:3ool
PDBsum3ool
PubMed21029741
UniProtP03882|SCE1_YEAST Intron-encoded endonuclease I-SceI (Gene Name=SCEI)

[Back to BioLiP]