Structure of PDB 3o62 Chain A Binding Site BS02

Receptor Information
>3o62 Chain A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>3o62 Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tagttataggtggacgtctaagatggttttcacataaacctttgacgagg
tagttttccgatgttgaggggaatcacggtgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o62 Consequences of Cisplatin binding on nucleosome structure and dynamics.
Resolution3.216 Å
Binding residue
(original residue number in PDB)		H39 R40 Y41 G44 V46 A47 R49 R63 K64 L65 R69 R83 K115
Binding residue
(residue number reindexed from 1)		H2 R3 Y4 G7 V9 A10 R12 R26 K27 L28 R32 R46 K78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3o62, PDBe:3o62, PDBj:3o62
PDBsum3o62
PubMed21168769
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]