Structure of PDB 3o3g Chain A Binding Site BS02

Receptor Information
>3o3g Chain A (length=222) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIDELYKKEFGIVAGVDEAGRGCLAGPVVAAAVVLEKEIEGINDSKQLSP
AKRERLLDEIMEKAAVGIGIASPEEIDLYNIFNATKLAMNRALENLSVKP
SFVLVDGKGIELSVPGTCLVKGDQKSKLIGAASIVAKVFRDRLMSEFHRM
YPQFSFHKHKGYATKEHLNEIRKNGVLPIHRLSFEPVLELLTDDLLREFF
EKGLISENRFERILNLLGARKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o3g Crystal Structures of RNase H2 in Complex with Nucleic Acid Reveal the Mechanism of RNA-DNA Junction Recognition and Cleavage.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		G21 R22 G23 K47 D107 G108 V121 K122 K138 K159 H160 Y163
Binding residue
(residue number reindexed from 1)		G20 R21 G22 K46 D106 G107 V120 K121 K137 K158 H159 Y162
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0030145 manganese ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006298 mismatch repair
GO:0006401 RNA catabolic process
GO:0043137 DNA replication, removal of RNA primer
Cellular Component
GO:0005737 cytoplasm
GO:0032299 ribonuclease H2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3o3g, PDBe:3o3g, PDBj:3o3g
PDBsum3o3g
PubMed21095591
UniProtQ9X017|RNH2_THEMA Ribonuclease HII (Gene Name=rnhB)

[Back to BioLiP]