Structure of PDB 3n97 Chain A Binding Site BS02

Receptor Information
>3n97 Chain A (length=53) Species: 271 (Thermus aquaticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKLSEREAMVLKMRKGLIDGREHTLEEVGAYFGVTRERIRQIENKALRKL
RHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3n97 The RNA Polymerase alpha Subunit Recognizes the DNA Shape of the Upstream Promoter Element.
Resolution3.252 Å
Binding residue
(original residue number in PDB)
R387 T397 L398 E410 R413
Binding residue
(residue number reindexed from 1)
R14 T24 L25 E37 R40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3n97, PDBe:3n97, PDBj:3n97
PDBsum3n97
PubMed33205945
UniProtQ9EZJ8|SIGA_THEAQ RNA polymerase sigma factor SigA (Gene Name=sigA)

[Back to BioLiP]