Structure of PDB 3mzh Chain A Binding Site BS02

Receptor Information
>3mzh Chain A (length=225) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYI
IISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEV
RAVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGR
VAKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFA
HRGWIRLEGKSVLISDSERLARRAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mzh Crystal Structure of Camp Receptor Protein from Mycobacterium Tuberculosis in Complex with DNA and cAMP
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D145 V146 A186 S187 E189 T190
Binding residue
(residue number reindexed from 1)		D146 V147 A187 S188 E190 T191
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0030552 cAMP binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3mzh, PDBe:3mzh, PDBj:3mzh
PDBsum3mzh
PubMed
UniProtP9WMH3|CRPL_MYCTU CRP-like cAMP-activated global transcriptional regulator (Gene Name=crp)

[Back to BioLiP]