Structure of PDB 3mqk Chain A Binding Site BS02

Receptor Information
>3mqk Chain A (length=328) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGP
TSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAG
KEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLRSAVKRRLRTRKVYY
IEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGP
FKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKD
SAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQ
EMLEKTKGIAVDVEKVFMPRDWYPKLWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mqk Structural and functional evidence of high specificity of Cbf5 for ACA trinucleotide.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
K77 G269 V323 K325 V326
Binding residue
(residue number reindexed from 1)
K67 G259 V313 K315 V316
Enzymatic activity
Catalytic site (original residue number in PDB) D85 Y113 R184
Catalytic site (residue number reindexed from 1) D75 Y103 R174
Enzyme Commision number 5.4.99.25: tRNA pseudouridine(55) synthase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0160148 tRNA pseudouridine(55) synthase activity
Biological Process
GO:0000495 box H/ACA sno(s)RNA 3'-end processing
GO:0001522 pseudouridine synthesis
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0009451 RNA modification
GO:0031118 rRNA pseudouridine synthesis
GO:0031119 tRNA pseudouridine synthesis
GO:0031120 snRNA pseudouridine synthesis
GO:1990481 mRNA pseudouridine synthesis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3mqk, PDBe:3mqk, PDBj:3mqk
PDBsum3mqk
PubMed21149572
UniProtQ7LWY0|TRUB_PYRFU Probable tRNA pseudouridine synthase B (Gene Name=truB)

[Back to BioLiP]