Structure of PDB 3mln Chain A Binding Site BS02

Receptor Information
>3mln Chain A (length=206) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEI
ERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSM
TKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIID
RFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFV
HNNSKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mln Structure of an Ebf1:DNA complex reveals unusual DNA recognition and structural homology with Rel proteins
Resolution2.4 Å
Binding residue
(original residue number in PDB)		K64 S169 G171 N174 N197 L199 N201 A202 G203 P205 F233 H235 N236 N237
Binding residue
(residue number reindexed from 1)		K30 S135 G137 N140 N163 L165 N167 A168 G169 P171 F199 H201 N202 N203
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3mln, PDBe:3mln, PDBj:3mln
PDBsum3mln
PubMed20876732
UniProtQ07802|COE1_MOUSE Transcription factor COE1 (Gene Name=Ebf1)

[Back to BioLiP]