Structure of PDB 3mip Chain A Binding Site BS02

Receptor Information

>3mip Chain A (length=161) Species: 32630 (synthetic construct)

TLQPTEAAYIAGFLDGDGSIYARLEPRPDYKDIKYQVRLAISFIQRKDKF
PYLQDIYDQLGKRGILRKDRGDGIADYRIYGSTHLSIILPDLVPYLRIKK
KQANRILHIINLYPQAQKNPSKFLDLVKIVDDVQNLNKRADELKSTNYDR
LLEEFLKAGKI

Ligand information

>3mip Chain D (length=24)

cggagcggtctcacgaccgcctgc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3mip Computational reprogramming of homing endonuclease specificity at multiple adjacent base pairs.
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): D22 G23 S24 Y26 R28 E30 R43 I49 Q50 R51 K54 R75 I79 Q139 N142
• Binding residue (residue number reindexed from 1): D17 G18 S19 Y21 R23 E25 R38 I44 Q45 R46 K49 R70 I74 Q134 N137

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 18:48:38 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3mip', asym_id = 'A', bs = 'BS02', title = 'Computational reprogramming of homing endonuclease specificity at multiple adjacent base pairs.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3mip', asym_id='A', bs='BS02', title='Computational reprogramming of homing endonuclease specificity at multiple adjacent base pairs.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004519', uniprot = '', pdbid = '3mip', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519', uniprot='', pdbid='3mip', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>