Structure of PDB 3mht Chain A Binding Site BS02

Receptor Information
>3mht Chain A (length=327) Species: 726 (Haemophilus haemolyticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mht Enzymatic C5-cytosine methylation of DNA: mechanistic implications of new crystal structures for HhaL methyltransferase-DNA-AdoHcy complexes.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
G78 C81 S85 I86 S87 R97 E119 V121 K162 R165 T226 R228 Q237 R240 Y242 I249 T250 S252 A253 Y254 G256 G303 N304
Binding residue
(residue number reindexed from 1)
G78 C81 S85 I86 S87 R97 E119 V121 K162 R165 T226 R228 Q237 R240 Y242 I249 T250 S252 A253 Y254 G256 G303 N304
Enzymatic activity
Catalytic site (original residue number in PDB) C81 E119 R163 R165
Catalytic site (residue number reindexed from 1) C81 E119 R163 R165
Enzyme Commision number 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003886 DNA (cytosine-5-)-methyltransferase activity
GO:0008168 methyltransferase activity
Biological Process
GO:0009307 DNA restriction-modification system
GO:0032259 methylation

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3mht, PDBe:3mht, PDBj:3mht
PDBsum3mht
PubMed8800212
UniProtP05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)

[Back to BioLiP]