Structure of PDB 3mg9 Chain A Binding Site BS02

Receptor Information

>3mg9 Chain A (length=255) Species: 164851 (uncultured soil bacterium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AAAASMNGIRWIASYPKAGNTWVRCMLAAYITGKAPQVWNDIDAESLTLE
AMLRFGDLPPAEPMEPVLVKTHLKADVPVLGLYGEATAKVLYLVRNPRDM
LLSSMRMASISRDDVEKSRDFARKFIANEGLGWNGGVGLGSWPENVRSWT
ESSSDRFPNADVLTMRYEDLKGDPVARFSEIVEFLDLGGPVDIEDIRRAV
AASTLERMRELEKRSEGRYDQSLSFLGEDIESDYQELLHGDSGFALYAKQ
YGYAG

Ligand information

>3mg9 Chain C (length=7) Species: 93944 (Nonomuraea gerenzanensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GFIGGFI

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3mg9 Crystal Structures of the Glycopeptide Sulfotransferase Teg12 in a Complex with the Teicoplanin Aglycone.
Resolution	2.27 Å
Binding residue (original residue number in PDB)	M208 L211 E212 S215 E216
Binding residue (residue number reindexed from 1)	M208 L211 E212 S215 E216

Enzymatic activity

Catalytic site (original residue number in PDB)	K12 H67 S98
Catalytic site (residue number reindexed from 1)	K17 H72 S103
Enzyme Commision number	2.8.2.-

Gene Ontology

	Molecular Function
GO:0008146	sulfotransferase activity
GO:0016740	transferase activity
GO:0042277	peptide binding

	Biological Process
GO:0051923	sulfation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3mg9, PDBe:3mg9, PDBj:3mg9
PDBsum	3mg9
PubMed	20361791
UniProt	B7T1D7

[Back to BioLiP]