Structure of PDB 3mfk Chain A Binding Site BS02

Receptor Information
>3mfk Chain A (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQ
SFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNI
IHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3mfk Structural basis of Ets1 cooperative binding to palindromic sequences on stromelysin-1 promoter DNA.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q336 L337 W375 K379 K381 M384 K388 R391 Y396 K399
Binding residue
(residue number reindexed from 1)		Q35 L36 W74 K78 K80 M83 K87 R90 Y95 K98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3mfk, PDBe:3mfk, PDBj:3mfk
PDBsum3mfk
PubMed20686355
UniProtP14921|ETS1_HUMAN Protein C-ets-1 (Gene Name=ETS1)

[Back to BioLiP]