Structure of PDB 3lwp Chain A Binding Site BS02

Receptor Information
>3lwp Chain A (length=317) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGP
TSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAG
KEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRLRTRKVYYIEVLEIEGRD
VLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITL
HDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGA
DLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIA
VDVEKVFMPRDWYPKLW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lwp Glycosidic bond conformation preference plays a pivotal role in catalysis of RNA pseudouridylation: a combined simulation and structural study.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
H63 H80 G82 T83 L107 Y113 G180 Y182 I183 R184
Binding residue
(residue number reindexed from 1)
H53 H70 G72 T73 L97 Y103 G160 Y162 I163 R164
Enzymatic activity
Catalytic site (original residue number in PDB) D85 Y113 R184
Catalytic site (residue number reindexed from 1) D75 Y103 R164
Enzyme Commision number 5.4.99.25: tRNA pseudouridine(55) synthase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0160148 tRNA pseudouridine(55) synthase activity
Biological Process
GO:0000495 box H/ACA sno(s)RNA 3'-end processing
GO:0001522 pseudouridine synthesis
GO:0006396 RNA processing
GO:0008033 tRNA processing
GO:0009451 RNA modification
GO:0031118 rRNA pseudouridine synthesis
GO:0031119 tRNA pseudouridine synthesis
GO:0031120 snRNA pseudouridine synthesis
GO:1990481 mRNA pseudouridine synthesis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3lwp, PDBe:3lwp, PDBj:3lwp
PDBsum3lwp
PubMed20615421
UniProtQ7LWY0|TRUB_PYRFU Probable tRNA pseudouridine synthase B (Gene Name=truB)

[Back to BioLiP]