Structure of PDB 3lsp Chain A Binding Site BS02

Receptor Information

>3lsp Chain A (length=194) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PRAEQKQQTRHALMSAARHLMESGRGFGSLSLREVTRAAGIVPAGFYRHF
SDMDQLGLALVAEVDETFRATLRAVRRNEFELGGLIDASVRIFLDAVGAN
RSQFLFLAREQYGGSLPIRQAIASLRQRITDDLAADLALLNKMPHLDGAA
LDVFADLVVKTVFATLPELIDHLMPAAKITHQLRFIMIGGKHWH

Ligand information

>3lsp Chain D (length=24) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgagtcaacaagcgttcactgatg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3lsp Structural basis for the transcriptional regulation of membrane lipid homeostasis.
Resolution	2.66 Å
Binding residue (original residue number in PDB)	R5 S34 L35 R36 R40 Y50
Binding residue (residue number reindexed from 1)	R2 S31 L32 R33 R37 Y47
Binding affinity	PDBbind-CN: Kd=2.2uM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0001217	DNA-binding transcription repressor activity
GO:0003677	DNA binding

	Biological Process
GO:0045892	negative regulation of DNA-templated transcription
GO:0045922	negative regulation of fatty acid metabolic process

	Cellular Component
GO:0032993	protein-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3lsp, PDBe:3lsp, PDBj:3lsp
PDBsum	3lsp
PubMed	20639888
UniProt	Q9HUS3

[Back to BioLiP]