Structure of PDB 3ldy Chain A Binding Site BS02

Receptor Information
>3ldy Chain A (length=142) Species: 43263 (Pseudomonas alcaligenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTQCPRCQRNLAADEFYAGSSKMCKGCMTWQNLSYNANKEGHANTFTKAT
FLAWYGLSAQRHCGYCGISEAGFTSLHRTNPRGYHIQCLGVDRSDSFEGY
SPQNARLACFICNRIKSNIFSASEMDVLGEAISKAWHGRGIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ldy Unusual target site disruption by the rare-cutting HNH restriction endonuclease PacI.
Resolution1.97 Å
Binding residue
(original residue number in PDB)		Y17 G19 S20 S21 M28 N32 N36 K39 E40 N80 P81 Y84 H85 I86 Q87 C88 G90 V91 D92 R93 F110 R114 S117 N118
Binding residue
(residue number reindexed from 1)		Y17 G19 S20 S21 M28 N32 N36 K39 E40 N80 P81 Y84 H85 I86 Q87 C88 G90 V91 D92 R93 F110 R114 S117 N118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:3ldy, PDBe:3ldy, PDBj:3ldy
PDBsum3ldy
PubMed20541511
UniProtD5MNX7

[Back to BioLiP]