Structure of PDB 3l2c Chain A Binding Site BS02

Receptor Information

>3l2c Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNS
SAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLN

Ligand information

>3l2c Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gttgtttacatag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3l2c Structure of the human FOXO4-DBD-DNA complex at 1.9 A resolution reveals new details of FOXO binding to the DNA
Resolution	1.868 Å
Binding residue (original residue number in PDB)	L120 N141 S142 R151 H152 S155 K162 S171 S172 W174
Binding residue (residue number reindexed from 1)	L28 N49 S50 R59 H60 S63 K70 S79 S80 W82
Binding affinity	PDBbind-CN: Kd=360nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3l2c, PDBe:3l2c, PDBj:3l2c
PDBsum	3l2c
PubMed	21123876
UniProt	P98177\|FOXO4_HUMAN Forkhead box protein O4 (Gene Name=FOXO4)

[Back to BioLiP]