Structure of PDB 3kxt Chain A Binding Site BS02

Receptor Information
>3kxt Chain A (length=56) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKL
PDDYPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kxt Crystal structure of the crenarchaeal conserved chromatin protein Cren7 and double-stranded DNA complex
Resolution1.602 Å
Binding residue
(original residue number in PDB)		R33 R51 H52 K53
Binding residue
(residue number reindexed from 1)		R29 R47 H48 K49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3kxt, PDBe:3kxt, PDBj:3kxt
PDBsum3kxt
PubMed20512977
UniProtQ97ZE3|CREN7_SACS2 Chromatin protein Cren7 (Gene Name=creN7)

[Back to BioLiP]