Structure of PDB 3jtg Chain A Binding Site BS02

Receptor Information
>3jtg Chain A (length=95) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKN
SNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jtg Crystal structure of mouse Elf3 C-terminal DNA-binding domain in complex with type II TGF-beta receptor promoter DNA.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y326 R331 R334 R344 R349 L350
Binding residue
(residue number reindexed from 1)		Y55 R60 R63 R73 R78 L79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3jtg, PDBe:3jtg, PDBj:3jtg
PDBsum3jtg
PubMed20079749
UniProtQ3UPW2|ELF3_MOUSE ETS-related transcription factor Elf-3 (Gene Name=Elf3)

[Back to BioLiP]