Structure of PDB 3jso Chain A Binding Site BS02

Receptor Information

>3jso Chain A (length=188) Species: 83333 (Escherichia coli K-12)

KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALA
RKGVIEIVSGASRGIRLLGLPLVGRVAAGEPLIEGHYQVDPSLFKPNADF
LLRVSGMSMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVARLKKQ
GNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRNG

Ligand information

>3jso Chain D (length=22)

tatactgtatatatatacagta

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3jso Structure of the LexA-DNA complex and implications for SOS box measurement.
• Resolution: 2.29 Å
• Binding residue (original residue number in PDB): T27 R28 N41 S60 G61 S63 R64
• Binding residue (residue number reindexed from 1): T26 R27 N40 S59 G60 S62 R63
• Binding affinity: PDBbind-CN: Kd=0.80nM

Enzymatic activity

• Catalytic site (original residue number in PDB): M118 S119 E152 A156
• Catalytic site (residue number reindexed from 1): M107 S108 E141 A145
• Enzyme Commision number: 3.4.21.88: repressor LexA.

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0004252 serine-type endopeptidase activity
• GO:0005515 protein binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006260 DNA replication
• GO:0006281 DNA repair
• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0006508 proteolysis
• GO:0006974 DNA damage response
• GO:0009432 SOS response
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3jso, PDBe:3jso, PDBj:3jso
• PDBsum: 3jso
• PubMed: 20703307
• UniProt: P0A7C2|LEXA_ECOLI LexA repressor (Gene Name=lexA)