Structure of PDB 3il2 Chain A Binding Site BS02

Receptor Information
>3il2 Chain A (length=204) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GMKVPEAAISRLITYLRILEELEAQGVHRTSSEQLGELAQVTAFQVRKDL
SYFGSYGTGYTVPVLKRELRHILGLNRKWGLCIVGMGDLGSALADYPGFG
ESFELRGFFDVDPEKVGRPVRGGVIEHVDLLPQRVPGRIEIALLTVPREA
AQKAADLLVAAGIKGILNFAPVVLEVPKEVAVENVDFLAGLTRLSFAILN
PKWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3il2 Structural basis for NADH/NAD+ redox sensing by a Rex family repressor.
Resolution2.49 Å
Binding residue
(original residue number in PDB)		P4 R10 F43 Q44 K47
Binding residue
(residue number reindexed from 1)		P5 R11 F44 Q45 K48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0051775 response to redox state
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3il2, PDBe:3il2, PDBj:3il2
PDBsum3il2
PubMed20513431
UniProtQ72I39|REX_THET2 Redox-sensing transcriptional repressor Rex (Gene Name=rex)

[Back to BioLiP]