Structure of PDB 3h8o Chain A Binding Site BS02

Receptor Information

>3h8o Chain A (length=206) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSHSWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVF
GKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQT
FNFVLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDS
RGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLT
FRKILL

Ligand information

>3h8o Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcgctataataca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3h8o Structure determination of DNA methylation lesions N1-meA and N3-meC in duplex DNA using a cross-linked protein-DNA system.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	F102 G103 R241 K242
Binding residue (residue number reindexed from 1)	F50 G51 R189 K190

Enzymatic activity

Enzyme Commision number

1.14.11.33: DNA oxidative demethylase.

Gene Ontology

	Biological Process
GO:0006281	DNA repair

View graph for
Biological Process

External links

PDB	RCSB:3h8o, PDBe:3h8o, PDBj:3h8o
PDBsum	3h8o
PubMed	20223766
UniProt	Q6NS38\|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 (Gene Name=ALKBH2)

[Back to BioLiP]