Structure of PDB 3gxv Chain A Binding Site BS02

Receptor Information
>3gxv Chain A (length=122) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDHLKHLQQLQNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFE
IALKLHEEDCPIDENFIRQKMPKDKQIKEEDLVAIFAASPIDNIEAYVEE
IKNASIKRKLFGLANTIREQAH
Ligand information
>3gxv Chain D (length=26) Species: 210 (Helicobacter pylori) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VEEIKNASIKRKLFGLANTIREQALE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gxv Three-dimensional structure of N-terminal domain of DnaB helicase and helicase-primase interactions in Helicobacter pylori
Resolution2.2 Å
Binding residue
(original residue number in PDB)		H3 L110 F111 A114 I117 R118
Binding residue
(residue number reindexed from 1)		H3 L110 F111 A114 I117 R118
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003678 DNA helicase activity
GO:0005524 ATP binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3gxv, PDBe:3gxv, PDBj:3gxv
PDBsum3gxv
PubMed19841750
UniProtO25916|DNAB_HELPY Replicative DNA helicase DnaB (Gene Name=dnaB)

[Back to BioLiP]