Structure of PDB 3gxq Chain A Binding Site BS02

Receptor Information
>3gxq Chain A (length=53) Species: 367830 (Staphylococcus aureus subsp. aureus USA300) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NSVFFGKKKKVSLHLLVDPDMKDEIIKYAQEKDFDNVSQAGREILKKGLE
QIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gxq The Staphylococcus aureus pSK41 plasmid-encoded ArtA protein is a master regulator of plasmid transmission genes and contains a RHH motif used in alternate DNA-binding modes.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		H20 L22
Binding residue
(residue number reindexed from 1)		H14 L16
Binding affinityPDBbind-CN: Kd=127nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:3gxq, PDBe:3gxq, PDBj:3gxq
PDBsum3gxq
PubMed19759211
UniProtA0A0H2XIU6

[Back to BioLiP]