Structure of PDB 3gjo Chain A Binding Site BS02

Receptor Information
>3gjo Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQR
IVDILYATDEGFVIPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gjo An EB1-binding motif acts as a microtubule tip localization signal
Resolution2.5 Å
Binding residue
(original residue number in PDB)		E213 Y217
Binding residue
(residue number reindexed from 1)		E22 Y26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008017 microtubule binding

View graph for
Molecular Function
External links
PDB RCSB:3gjo, PDBe:3gjo, PDBj:3gjo
PDBsum3gjo
PubMed19632184
UniProtQ15691|MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 (Gene Name=MAPRE1)

[Back to BioLiP]