Structure of PDB 3gii Chain A Binding Site BS02

Receptor Information

>3gii Chain A (length=341) Species: 273057 (Saccharolobus solfataricus P2)

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

Ligand information

>3gii Chain E (length=19)

ctaacgctaccatccaacc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3gii Impact of conformational heterogeneity of OxoG lesions and their pairing partners on bypass fidelity by Y family polymerases.
• Resolution: 2.6 Å
• Binding residue (original residue number in PDB): V32 R36 S40 G41 A42 P60 V62 A220 R242 K243 S244 I245 G246 R247 I248 T250 K252 L293 R331 R332 R336
• Binding residue (residue number reindexed from 1): V32 R36 S40 G41 A42 P60 V62 A220 R242 K243 S244 I245 G246 R247 I248 T250 K252 L293 R331 R332 R336

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3gii, PDBe:3gii, PDBj:3gii
• PDBsum: 3gii
• PubMed: 19446528
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)