Structure of PDB 3gfi Chain A Binding Site BS02

Receptor Information
>3gfi Chain A (length=143) Species: 111955 (Sulfurisphaera tokodaii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTM
AYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRKILIEITEKGLET
FNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gfi ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R91 R92
Binding residue
(residue number reindexed from 1)		R86 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006950 response to stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3gfi, PDBe:3gfi, PDBj:3gfi
PDBsum3gfi
PubMed19509310
UniProtQ96ZY1

[Back to BioLiP]