Structure of PDB 3g73 Chain A Binding Site BS02

Receptor Information
>3g73 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGW
KNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3g73 Structure of the FoxM1 DNA-recognition domain bound to a promoter sequence
Resolution2.21 Å
Binding residue
(original residue number in PDB)		L259 K260 R286 H287 S290 R297 W308
Binding residue
(residue number reindexed from 1)		L28 K29 R55 H56 S59 R66 W77
Binding affinityPDBbind-CN: Kd=7uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0000086 G2/M transition of mitotic cell cycle
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3g73, PDBe:3g73, PDBj:3g73
PDBsum3g73
PubMed20360045
UniProtQ08050|FOXM1_HUMAN Forkhead box protein M1 (Gene Name=FOXM1)

[Back to BioLiP]