Structure of PDB 3g6t Chain A Binding Site BS02

Receptor Information
>3g6t Chain A (length=78) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIID
KIRRKNCPACRYRKCLQAGMNLEARKTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3g6t DNA binding site sequence directs glucocorticoid receptor structure and activity.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		C450 H451 Y452 K461 K465 R511
Binding residue
(residue number reindexed from 1)		C14 H15 Y16 K25 K29 R75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3g6t, PDBe:3g6t, PDBj:3g6t
PDBsum3g6t
PubMed19372434
UniProtP06536|GCR_RAT Glucocorticoid receptor (Gene Name=Nr3c1)

[Back to BioLiP]