Structure of PDB 3fdq Chain A Binding Site BS02

Receptor Information

>3fdq Chain A (length=140) Species: 1639 (Listeria monocytogenes)

SEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEIYHLLTEFY
QAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSL
NDLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRK

Ligand information

>3fdq Chain D (length=15)

tatttttttaaaaaa

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3fdq Recognition of AT-Rich DNA Binding Sites by the MogR Repressor.
• Resolution: 1.75 Å
• Binding residue (original residue number in PDB): K93 V94 Y121 K124 P138 G139 R140 R142 K143
• Binding residue (residue number reindexed from 1): K90 V91 Y118 K121 P135 G136 R137 R139 K140

External links

• PDB: RCSB:3fdq, PDBe:3fdq, PDBj:3fdq
• PDBsum: 3fdq
• PubMed: 19446532
• UniProt: P0DJO8|MOGR_LISMO Motility gene repressor MogR (Gene Name=mogR)