Structure of PDB 3f9x Chain A Binding Site BS02

Receptor Information

>3f9x Chain A (length=160) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFV
VEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNR
LGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKA
SIEAHPWLKH

Ligand information

>3f9x Chain G (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KRHRKVLRD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3f9x Structural origins for the product specificity of SET domain protein methyltransferases.
Resolution	1.25 Å
Binding residue (original residue number in PDB)	R228 S267 T268
Binding residue (residue number reindexed from 1)	R36 S75 T76

Enzymatic activity

Enzyme Commision number

2.1.1.-
2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.

Gene Ontology

	Molecular Function
GO:0042799	histone H4K20 methyltransferase activity

View graph for
Molecular Function

External links

PDB	RCSB:3f9x, PDBe:3f9x, PDBj:3f9x
PDBsum	3f9x
PubMed	19088188
UniProt	Q9NQR1\|KMT5A_HUMAN N-lysine methyltransferase KMT5A (Gene Name=KMT5A)

[Back to BioLiP]