Structure of PDB 3e44 Chain A Binding Site BS02

Receptor Information

>3e44 Chain A (length=247) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFIKPIYQDINSILIGQKVKRAAGEPFEKLVYKFLKENLSDLTFKQYEYL
NDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQN
DTADILLVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDNKE
FDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQF
HVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI

Ligand information

>3e44 Chain F (length=7) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaccggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3e44 DNA distortion and specificity in a sequence-specific endonuclease.
Resolution	2.52 Å
Binding residue (original residue number in PDB)	G92 K93 Q109
Binding residue (residue number reindexed from 1)	G82 K83 Q99

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3e44, PDBe:3e44, PDBj:3e44
PDBsum	3e44
PubMed	18762194
UniProt	P17743\|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]