Structure of PDB 3e41 Chain A Binding Site BS02

Receptor Information

>3e41 Chain A (length=246) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SFIKPIYQDINSILIGQKVKRPAGEPFEKLVYKFLKENLSDLTFKQYEYL
NDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQN
DTADILLVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDNKE
FDLFDINYLEVDWELNGDLVCVSTSFAELFKSEPSELYINWAAAMQIQFH
VRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI

Ligand information

>3e41 Chain F (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccggtcgaccggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3e41 DNA distortion and specificity in a sequence-specific endonuclease.
Resolution	2.73 Å
Binding residue (original residue number in PDB)	Q109 N110 D111 D127 K129 T130 S136 F138 A139 P140 N141 S144 K147 A205 Q207
Binding residue (residue number reindexed from 1)	Q99 N100 D101 D117 K119 T120 S126 F128 A129 P130 N131 S134 K137 A194 Q196

Enzymatic activity

Enzyme Commision number

3.1.21.4: type II site-specific deoxyribonuclease.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004519	endonuclease activity
GO:0009036	type II site-specific deoxyribonuclease activity

	Biological Process
GO:0009307	DNA restriction-modification system

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3e41, PDBe:3e41, PDBj:3e41
PDBsum	3e41
PubMed	18762194
UniProt	P17743\|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]