Structure of PDB 3do7 Chain A Binding Site BS02

Receptor Information

>3do7 Chain A (length=296) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTE
ASKTQPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCR
VRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQ
EVDMNVVRICFQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRIN
KESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAI
VFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSY

Ligand information

>3do7 Chain D (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgggaattccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3do7 NF-kapppaB p52:RelB heterodimer uses different binding modes to recognize different kappaB DNA
Resolution	3.05 Å
Binding residue (original residue number in PDB)	R117 R119 R125 A127 S129
Binding residue (residue number reindexed from 1)	R30 R32 R38 A40 S42

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3do7, PDBe:3do7, PDBj:3do7
PDBsum	3do7
PubMed
UniProt	Q04863\|RELB_MOUSE Transcription factor RelB (Gene Name=Relb)

[Back to BioLiP]