Structure of PDB 3cyy Chain A Binding Site BS02

Receptor Information
>3cyy Chain A (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPTKVTLVKSAKNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKI
NGTVTENMSLTDAKTLIERSKGKLKMVVQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cyy Domain-swapped dimerization of ZO-1 PDZ2 generates specific and regulatory connexin43-binding sites
Resolution2.4 Å
Binding residue
(original residue number in PDB)
E197 Y198 L200 R201 L202 E238 N239
Binding residue
(residue number reindexed from 1)
E15 Y16 L18 R19 L20 E56 N57
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3cyy, PDBe:3cyy, PDBj:3cyy
PDBsum3cyy
PubMed18636092
UniProtQ07157|ZO1_HUMAN Tight junction protein ZO-1 (Gene Name=TJP1)

[Back to BioLiP]