Structure of PDB 3cmy Chain A Binding Site BS02

Receptor Information
>3cmy Chain A (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWF
SNRRARWRKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cmy Structural Basis for DNA Recognition by the Human PAX3 Homeodomain.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		R2 S4 R5 Y25 S50 R53
Binding residue
(residue number reindexed from 1)		R3 S5 R6 Y26 S51 R54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3cmy, PDBe:3cmy, PDBj:3cmy
PDBsum3cmy
PubMed19199574
UniProtP23760|PAX3_HUMAN Paired box protein Pax-3 (Gene Name=PAX3)

[Back to BioLiP]