Structure of PDB 3cal Chain A Binding Site BS02

Receptor Information
>3cal Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHE
GGQSYKIGDTWRRPHEGGYMLECVCLGNGKGEWTCKPI
Ligand information
>3cal Chain D (length=18) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGIVTGAVSDHTTVEDTK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cal Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains
Resolution1.7 Å
Binding residue
(original residue number in PDB)		T80 I95
Binding residue
(residue number reindexed from 1)		T18 I33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:3cal, PDBe:3cal, PDBj:3cal
PDBsum3cal
PubMed18713862
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]