Structure of PDB 3c6w Chain A Binding Site BS02

Receptor Information
>3c6w Chain A (length=51) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQ
E
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c6w The crystal structure of the ING5 PHD finger in complex with an H3K4me3 histone peptide.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
D203 P205
Binding residue
(residue number reindexed from 1)
D19 P21
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3c6w, PDBe:3c6w, PDBj:3c6w
PDBsum3c6w
PubMed18623064
UniProtQ8WYH8|ING5_HUMAN Inhibitor of growth protein 5 (Gene Name=ING5)

[Back to BioLiP]