Structure of PDB 3c2i Chain A Binding Site BS02

Receptor Information
>3c2i Chain A (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIM
YFEKVGDTSLDPNDFDFTVTGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c2i MeCP2 binding to DNA depends upon hydration at methyl-CpG
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K119 R133 S134 T158 V159
Binding residue
(residue number reindexed from 1)		K29 R43 S44 T68 V69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3c2i, PDBe:3c2i, PDBj:3c2i
PDBsum3c2i
PubMed18313390
UniProtP51608|MECP2_HUMAN Methyl-CpG-binding protein 2 (Gene Name=MECP2)

[Back to BioLiP]