Structure of PDB 3c28 Chain A Binding Site BS02

Receptor Information
>3c28 Chain A (length=299) Species: 2886926 (Escherichia phage P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPE
DVRDYLLYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRR
IRKENVDAGERAKQALAFERTDFDQVRSLMENSDRCQDIRNLAFLGIAYN
TLLRIAEIARIRVKDIMLIHALSLGVTKLVERWISVSGVADDPNNYLFCR
VRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDGQRYLAWSGHSAR
VGAARDMARAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c28 Detailed study on Synapsis in Cre-loxP recombination reaction
Resolution2.6 Å
Binding residue
(original residue number in PDB)		M44 S47 R50 R81 L83 K86 T87 H91 A131 K132 Q156 R159 R173 R241 V242 K244 L256 S257 A260 R282 Y283 W315 I320 Y324
Binding residue
(residue number reindexed from 1)		M25 S28 R31 R62 L64 K67 T68 H72 A112 K113 Q137 R140 R154 R200 V201 K203 L215 S216 A219 R240 Y241 W273 I278 Y282
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006310 DNA recombination
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3c28, PDBe:3c28, PDBj:3c28
PDBsum3c28
PubMed
UniProtP06956|RECR_BPP1 Recombinase cre (Gene Name=cre)

[Back to BioLiP]