Structure of PDB 3c0w Chain A Binding Site BS02

Receptor Information
>3c0w Chain A (length=223) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIKKNQVMNLGPNSKLLKEYKSQLIELNIEQFEAGIGLILGDAYIRSRDE
GKTYCMQFEWKNKAYMDHVCLLYDQWVLSPPHKKERVNHLGNLVITWGAQ
TFKHQAFNKLANLFIVNNKKTIPNNLVENYLTPMSLAYWFMDDGGKWDYN
KNSTNKSIVLNTQSFTFEEVEYLVKGLRNKFQLNCYVKINKNKPIIYIDS
MSYLIFYNLIKPYLIPQMMYKLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3c0w Crystal structures of I-SceI complexed to nicked DNA substrates: snapshots of intermediates along the DNA cleavage reaction pathway.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		P14 N15 L80 S81 H84 K86 R88 Q102 F104 K105 N163 Q165 S166 K193
Binding residue
(residue number reindexed from 1)		P12 N13 L78 S79 H82 K84 R86 Q100 F102 K103 N161 Q163 S164 K191
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3c0w, PDBe:3c0w, PDBj:3c0w
PDBsum3c0w
PubMed18424798
UniProtP03882|SCE1_YEAST Intron-encoded endonuclease I-SceI (Gene Name=SCEI)

[Back to BioLiP]