Structure of PDB 3bua Chain A Binding Site BS02

Receptor Information
>3bua Chain A (length=202) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGK
EHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEF
TLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRN
DLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKA
LK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bua A shared docking motif in TRF1 and TRF2 used for differential recruitment of telomeric proteins.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M122 E123
Binding residue
(residue number reindexed from 1)		M79 E80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042162 telomeric DNA binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0000723 telomere maintenance
GO:0031848 protection from non-homologous end joining at telomere
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bua, PDBe:3bua, PDBj:3bua
PDBsum3bua
PubMed18202258
UniProtQ15554|TERF2_HUMAN Telomeric repeat-binding factor 2 (Gene Name=TERF2)

[Back to BioLiP]