Structure of PDB 3bu0 Chain A Binding Site BS02

Receptor Information

>3bu0 Chain A (length=203) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SWRHIRAEGLDSSYTVLFGKAEADEIFQELEKEVEYFTGALARVQVFGKW
HSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNF
VLINRYKDGSDHIGEHRDDCRELAPGSPIASVSFGASRDFVFRHKDSRGK
SPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK
ILL

Ligand information

>3bu0 Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcgcaataataca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3bu0 Crystal structures of DNA/RNA repair enzymes AlkB and ABH2 bound to dsDNA.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	F102 G103 K104 R198 G204 K205 R241 K242 K243
Binding residue (residue number reindexed from 1)	F47 G48 K49 R143 G149 K150 R186 K187 K188

Enzymatic activity

Enzyme Commision number

1.14.11.33: DNA oxidative demethylase.

Gene Ontology

	Biological Process
GO:0006281	DNA repair

View graph for
Biological Process

External links

PDB	RCSB:3bu0, PDBe:3bu0, PDBj:3bu0
PDBsum	3bu0
PubMed	18432238
UniProt	Q6NS38\|ALKB2_HUMAN DNA oxidative demethylase ALKBH2 (Gene Name=ALKBH2)

[Back to BioLiP]