Structure of PDB 3bs1 Chain A Binding Site BS02

Receptor Information
>3bs1 Chain A (length=103) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGN
LKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNV
KKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bs1 Structure of the Staphylococcus aureus AgrA LytTR Domain Bound to DNA Reveals a Beta Fold with an Unusual Mode of Binding.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R170 Y183 H200 N201 S231 V232 R233
Binding residue
(residue number reindexed from 1)		R35 Y48 H65 N66 S96 V97 R98
Binding affinityPDBbind-CN: Kd=80nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000156 phosphorelay response regulator activity
GO:0003677 DNA binding

View graph for
Molecular Function
External links
PDB RCSB:3bs1, PDBe:3bs1, PDBj:3bs1
PDBsum3bs1
PubMed18462677
UniProtP0A0I7|AGRA_STAAU Accessory gene regulator protein A (Gene Name=agrA)

[Back to BioLiP]