Structure of PDB 3bdn Chain A Binding Site BS02

Receptor Information
>3bdn Chain A (length=234) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGAL
FNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSE
YEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSM
TAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRGSGQ
VFLQPLNPQYPMIPESCSVVGKVIASQWPEETFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bdn Crystal structure of the lambda repressor and a model for pairwise cooperative operator binding
Resolution3.909 Å
Binding residue
(original residue number in PDB)		P6 M42 G43 S45 G46 N55 A56 N61
Binding residue
(residue number reindexed from 1)		P6 M42 G43 S45 G46 N55 A56 N61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001046 core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0042802 identical protein binding
Biological Process
GO:0010944 negative regulation of transcription by competitive promoter binding
GO:0019042 viral latency
GO:0019044 maintenance of viral latency
GO:0050434 positive regulation of viral transcription
GO:0098689 latency-replication decision

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3bdn, PDBe:3bdn, PDBj:3bdn
PDBsum3bdn
PubMed18432246
UniProtP03034|RPC1_LAMBD Repressor protein cI (Gene Name=cI)

[Back to BioLiP]