Structure of PDB 3agz Chain A Binding Site BS02

Receptor Information
>3agz Chain A (length=185) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILT
IEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVI
YPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLP
KTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3agz Peptide-binding sites as revealed by the crystal structures of the human Hsp40 Hdj1 C-terminal domain in complex with the octapeptide from human Hsp70
Resolution2.51 Å
Binding residue
(original residue number in PDB)		W212 K213 G215 T216 K217 I218 T219 F220 K306
Binding residue
(residue number reindexed from 1)		W57 K58 G60 T61 K62 I63 T64 F65 K151
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051082 unfolded protein binding
Biological Process
GO:0006457 protein folding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3agz, PDBe:3agz, PDBj:3agz
PDBsum3agz
PubMed20809635
UniProtP25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 (Gene Name=DNAJB1)

[Back to BioLiP]